PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G31320.1
Common NameASL6, LBD4, T19E23.11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family LBD
Protein Properties Length: 172aa    MW: 18697.2 Da    PI: 7.773
Description LOB domain-containing protein 4
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G31320.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260144.33.7e-45131121100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca+dCv++pyfpa++p+kfanvh++FGasnv k+l++lp ++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+a+lal++
  AT1G31320.1  13 PCAACKLLRRRCAQDCVFSPYFPADEPQKFANVHRVFGASNVNKMLQELPIHQRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDVLQAQLALAQ 110
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  +e
  AT1G31320.1 111 AE 112
                  76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.27512113IPR004883Lateral organ boundaries, LOB
PfamPF031958.8E-4513110IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008150Biological Processbiological_process
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKESSRKQGA ASPCAACKLL RRRCAQDCVF SPYFPADEPQ KFANVHRVFG ASNVNKMLQE  60
LPIHQRGDAV SSMVYEANAR VRDPVYGCVG AISSLQQQID VLQAQLALAQ AEVVHLRVRQ  120
STNFPGHGLC PDSPSSSGSP SSKQVSPQDN KGMFSHMDIV DEASLGESMW SC
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.499310.0flower
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO425624360.0
Genevisible257467_at0.0
Expression AtlasAT1G31320-
AtGenExpressAT1G31320-
ATTED-IIAT1G31320-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G31320.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9SHE9
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G31320
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4738390.0AB473839.1 Arabidopsis thaliana ASL6 mRNA for ASYMMETRIC LEAVES2-like 6 protein, complete cds.
GenBankBT0150670.0BT015067.1 Arabidopsis thaliana At1g31320 gene, complete cds.
GenBankBT0156650.0BT015665.1 Arabidopsis thaliana At1g31320 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_174417.11e-126LOB domain-containing protein 4
SwissprotQ9SHE91e-128LBD4_ARATH; LOB domain-containing protein 4
TrEMBLD7KL241e-125D7KL24_ARALL; LOB domain protein 4
STRINGAT1G31320.11e-125(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM13128340
Representative plantOGRP6016318
Publications ? help Back to Top
  1. Iwakawa H, et al.
    The ASYMMETRIC LEAVES2 gene of Arabidopsis thaliana, required for formation of a symmetric flat leaf lamina, encodes a member of a novel family of proteins characterized by cysteine repeats and a leucine zipper.
    Plant Cell Physiol., 2002. 43(5): p. 467-78
    [PMID:12040093]
  2. Shuai B,Reynaga-Peña CG,Springer PS
    The lateral organ boundaries gene defines a novel, plant-specific gene family.
    Plant Physiol., 2002. 129(2): p. 747-61
    [PMID:12068116]
  3. Lee DJ, et al.
    Genome-wide expression profiling of ARABIDOPSIS RESPONSE REGULATOR 7(ARR7) overexpression in cytokinin response.
    Mol. Genet. Genomics, 2007. 277(2): p. 115-37
    [PMID:17061125]
  4. Ko JH,Yang SH,Park AH,Lerouxel O,Han KH
    ANAC012, a member of the plant-specific NAC transcription factor family, negatively regulates xylary fiber development in Arabidopsis thaliana.
    Plant J., 2007. 50(6): p. 1035-48
    [PMID:17565617]
  5. Matsumura Y,Iwakawa H,Machida Y,Machida C
    Characterization of genes in the ASYMMETRIC LEAVES2/LATERAL ORGAN BOUNDARIES (AS2/LOB) family in Arabidopsis thaliana, and functional and molecular comparisons between AS2 and other family members.
    Plant J., 2009. 58(3): p. 525-37
    [PMID:19154202]
  6. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]